Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

BBQ Brisket Stuffed Potato with Crispy Cheese

Crispy-skin baked potatoes stuffed with tender shredded BBQ brisket, melted cheddar, and a dollop of cooling sour cream. Ready in under 30 minutes with rotisserie or leftover brisket.

Total time
25 min
Servings
2
Calories
620
Protein
38g
BBQ Brisket Stuffed Potato with Crispy Cheese
comfortsatisfyingamericanbeefcrispycreamytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Prick potatoes all over with a fork. Microwave on high for 12 minutes, turning halfway through, until tender inside.

  2. Step 2

    While potatoes cook, warm BBQ brisket and sauce together in a skillet over medium heat, stirring occasionally, 4 minutes.

  3. Step 3

    Halve each potato lengthwise. Scoop out centers, leaving a thin shell, and fluff the insides with a fork.

  4. Step 4

    Place potato halves skin-side down on a sheet pan. Divide BBQ brisket among the four halves, mounding it in the center.

  5. Step 5

    Top each with cheddar. Broil 4 inches from heat for 3 minutes until cheese melts and edges brown slightly.

  6. Step 6

    Top each potato with a dollop of sour cream and a pinch of fresh chives. Serve hot.

Tools you’ll need

  • microwave
  • skillet
  • sheet pan
  • broiler
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.