Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Beef & Onion Venetian

Tender beef sliced thin and seared fast, then braised with a mountain of caramelized onions and a splash of wine vinegar. This is the soul of fegato alla veneziana without the liver — rich, savory, and done in 20 minutes.

Total time
20 min
Servings
2
Calories
385
Protein
38g
Beef & Onion Venetian
comfortelegantitalianbeeftendersilkyweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice onions into thin half-moons. Heat 2 tbsp olive oil in a large skillet over medium-high until shimmering, ~1 minute.

  2. Step 2

    Add onions and a pinch of salt, stirring occasionally, until deep golden and very soft, 10–12 minutes. Transfer to a plate.

  3. Step 3

    Pat beef dry. Add another tbsp oil to the skillet over high heat until it smokes lightly, ~90 seconds.

  4. Step 4

    Sear beef in a single layer 60–90 seconds per side without moving. Season with salt and pepper. Remove to a plate.

  5. Step 5

    Return onions to the skillet, add wine and vinegar, scraping the bottom to loosen browned bits. Simmer 2 minutes.

  6. Step 6

    Return beef and any juices to the pan, toss gently, and remove from heat. Garnish with parsley and serve immediately.

Tools you’ll need

  • 12-inch stainless steel or cast iron skillet
  • wooden spoon
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.