CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Beef & Onion Venetian

Tender beef sliced thin and seared fast, then braised with a mountain of caramelized onions and a splash of wine vinegar. This is the soul of fegato alla veneziana without the liver — rich, savory, and done in 20 minutes.

Total time
20 min
Servings
2
Calories
385
Protein
38g
Beef & Onion Venetian
comfortelegantitalianbeeftendersilkyweeknightmain-dish

Ingredients

  • ¾ lb beef sirloin or tenderloin, thinly sliced
  • 3 whole yellow onions, large
  • 2 tbsp white wine vinegar
  • ⅓ cup dry white wine
  • 2 tbsp fresh parsley, chopped
  • 1 pinch salt and black pepper

Instructions

  1. 1

    Slice onions into thin half-moons. Heat 2 tbsp olive oil in a large skillet over medium-high until shimmering, ~1 minute.

  2. 2

    Add onions and a pinch of salt, stirring occasionally, until deep golden and very soft, 10–12 minutes. Transfer to a plate.

  3. 3

    Pat beef dry. Add another tbsp oil to the skillet over high heat until it smokes lightly, ~90 seconds.

  4. 4

    Sear beef in a single layer 60–90 seconds per side without moving. Season with salt and pepper. Remove to a plate.

  5. 5

    Return onions to the skillet, add wine and vinegar, scraping the bottom to loosen browned bits. Simmer 2 minutes.

  6. 6

    Return beef and any juices to the pan, toss gently, and remove from heat. Garnish with parsley and serve immediately.

Tools you’ll need

  • 12-inch stainless steel or cast iron skillet
  • wooden spoon
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.