Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Braciole with Marinara

Thin beef cutlets stuffed with Italian herbs and breadcrumbs, seared crispy, then finished in marinara sauce. A TikTok-easy riff on the classic Italian roll that's done in 20 minutes, not hours.

Total time
20 min
Servings
2
Calories
285
Protein
22g
Crispy Braciole with Marinara
comfortelegantitalianbeeftendercrispyweeknightdate-night

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix panko, Pecorino, parsley, and red pepper flakes in a small bowl.

  2. Step 2

    Lay cutlets on a cutting board, divide filling evenly, and roll tightly from the short end.

  3. Step 3

    Heat oil in a 10-inch skillet over medium-high until shimmering, about 60 seconds.

  4. Step 4

    Sear each braciole 90 seconds per side without moving, until golden brown.

  5. Step 5

    Pour marinara around the braciole, reduce heat to medium, and simmer 6–8 minutes covered.

  6. Step 6

    Tear basil over the top and serve immediately with crusty bread.

Tools you’ll need

  • 10-inch skillet
  • small bowl
  • cutting board
  • spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.