Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Min Beef Rendang with Roti Canai

Tender beef in a rich, spiced coconut curry — the TikTok shortcut version using a rendang paste base. Served with store-bought roti canai for an authentic plate in under 30 minutes.

Total time
25 min
Servings
2
Calories
580
Protein
45g
25-Min Beef Rendang with Roti Canai
comfortsatisfyingindonesianbeeftendercreamyweeknightdinner

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large skillet over medium-high until shimmering, about 90 seconds.

  2. Step 2

    Add beef in a single layer and sear 2 minutes per side without stirring. Transfer to a plate.

  3. Step 3

    Add red onion and garlic to the skillet, cook 90 seconds until fragrant and softened.

  4. Step 4

    Stir in rendang paste until it coats the onion, then pour in coconut milk and squeeze in lime juice.

  5. Step 5

    Return beef to the pan and simmer 8–10 minutes until sauce darkens and thickens, stirring occasionally.

  6. Step 6

    Warm roti canai in a dry skillet 30 seconds per side, then plate with beef rendang and garnish with cilantro.

Tools you’ll need

  • 12-inch skillet or large saucepan
  • wooden spoon or spatula
  • tongs
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.