Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Rendang Padang with Rice & Egg

Tender beef simmered in a rich, spiced coconut sauce inspired by Padang's iconic rendang — served with steamed rice, hard-boiled egg, and crispy sides. Tastes like a restaurant dish but comes together in 20 minutes.

Total time
20 min
Servings
2
Calories
520
Protein
42g
20-Min Rendang Padang with Rice & Egg
comfortboldindonesianbeeftendercreamyweeknightdinner

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over medium-high heat until it shimmers, about 60 seconds.

  2. Step 2

    Add beef in a single layer and sear without stirring for 2 minutes until edges brown, then stir and cook 1 more minute.

  3. Step 3

    Push beef to the side, add ginger and chili paste to the empty space, stir 30 seconds until fragrant.

  4. Step 4

    Pour in coconut milk and turmeric, stir well, and simmer on medium for 8 minutes until sauce thickens and deepens in color.

  5. Step 5

    Taste and season with salt and pepper; the sauce should cling to the beef and smell aromatic.

  6. Step 6

    Serve rendang over steamed rice alongside hard-boiled eggs, cucumber slices, and crispy krupuk or chips.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula
  • measuring spoons
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.