Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pan-Seared Beef Scaloppine with Mushroom Cream

Thin-pounded beef cutlets seared until golden, finished with a silky mushroom pan sauce. Restaurant-quality dinner in under 20 minutes.

Total time
18 min
Servings
2
Calories
420
Protein
32g
Pan-Seared Beef Scaloppine with Mushroom Cream
elegantsatisfyingitalianbeeftendercrispyweeknightdate-night

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Place beef between plastic wrap and pound thin with a meat mallet until about 1/8 inch thick.

  2. Step 2

    Season beef generously with salt and pepper on both sides.

  3. Step 3

    Heat 2 tbsp olive oil in a 12-inch skillet over medium-high until shimmering. Sear beef 60–90 seconds per side until golden; transfer to a plate.

  4. Step 4

    In the same skillet, sauté mushrooms and shallot until mushrooms release liquid and turn golden, about 5 minutes.

  5. Step 5

    Pour wine into the pan, scraping up browned bits. Simmer until liquid reduces by half, about 2 minutes.

  6. Step 6

    Stir in cream and return beef to pan. Heat through for 60 seconds, then serve garnished with fresh parsley.

Tools you’ll need

  • meat mallet
  • plastic wrap
  • 12-inch skillet
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.