Back to recipes
Biscoff Spread Toast
Crispy toast topped with creamy Biscoff spread, banana slices, and a drizzle of honey. Ready in 5 minutes—the ultimate sweet snack.
- Total time
- 5 min
- Servings
- 2
- Calories
- 285
- Protein
- 6g
casualindulgentvegetariancrispycreamysnacktoastsnack
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Toast bread until golden brown and edges curl slightly, about 2 minutes.
Step 2
Spread 1.5 tbsp Biscoff on each warm slice, letting it soften slightly.
Step 3
Slice banana into thin rounds and arrange over the spread.
Step 4
Drizzle with honey and serve immediately.
Tools you’ll need
- toaster
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
