Back to recipes
Nutella Banana Toast
Creamy Nutella and fresh banana slices on crispy toast—a 5-minute indulgence that tastes like dessert for breakfast or snack time. Requires just 4 ingredients and a toaster.
- Total time
- 5 min
- Servings
- 2
- Calories
- 312
- Protein
- 7g
quickindulgentvegetariancrispycreamyweeknightsnacktoast
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Toast bread until golden brown and crispy, 2-3 minutes.
Step 2
Spread 1.5 tbsp Nutella on each toast slice while still warm.
Step 3
Slice banana into 1/4-inch rounds and arrange over Nutella.
Step 4
Pinch of salt over top. Serve immediately.
Tools you’ll need
- toaster
- knife
- cutting board
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
