CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Pan-Fried Blutwurst with Warm Sauerkraut

German blood sausage crisped in a skillet, served alongside tangy sauerkraut with a touch of caraway. This is the weeknight version of a classic Berlin deli plate.

Total time
15 min
Servings
2
Calories
340
Protein
18g
Pan-Fried Blutwurst with Warm Sauerkraut
comfortcasualgermanporkcrispytenderweeknightmain-dish

Ingredients

  • 10 oz blutwurst (blood sausage), sliced into 1/2-inch rounds
  • 1.5 cups sauerkraut, drained
  • ½ medium yellow onion, thinly sliced
  • ½ tsp caraway seeds
  • ¼ cup beef or chicken broth
  • 2 tbsp whole grain mustard

Instructions

  1. 1

    Heat oil in a large skillet over medium-high until shimmering, about 90 seconds.

  2. 2

    Add blutwurst slices in a single layer. Sear without moving until edges brown, about 2 minutes per side.

  3. 3

    Transfer sausage to a plate. Add onion and caraway seeds to the same skillet, stir for 1 minute until fragrant.

  4. 4

    Stir in sauerkraut and broth. Simmer for 4 minutes until kraut is warm and liquid reduces slightly.

  5. 5

    Return blutwurst to the skillet. Drizzle with mustard, toss gently, and cook for 1 minute to heat through.

  6. 6

    Serve immediately in a shallow bowl or plate.

Tools you’ll need

  • 12-inch skillet or sauté pan
  • wooden spoon or spatula
  • tongs
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.