Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pan-Fried Blutwurst with Warm Sauerkraut

German blood sausage crisped in a skillet, served alongside tangy sauerkraut with a touch of caraway. This is the weeknight version of a classic Berlin deli plate.

Total time
15 min
Servings
2
Calories
340
Protein
18g
Pan-Fried Blutwurst with Warm Sauerkraut
comfortcasualgermanporkcrispytenderweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large skillet over medium-high until shimmering, about 90 seconds.

  2. Step 2

    Add blutwurst slices in a single layer. Sear without moving until edges brown, about 2 minutes per side.

  3. Step 3

    Transfer sausage to a plate. Add onion and caraway seeds to the same skillet, stir for 1 minute until fragrant.

  4. Step 4

    Stir in sauerkraut and broth. Simmer for 4 minutes until kraut is warm and liquid reduces slightly.

  5. Step 5

    Return blutwurst to the skillet. Drizzle with mustard, toss gently, and cook for 1 minute to heat through.

  6. Step 6

    Serve immediately in a shallow bowl or plate.

Tools you’ll need

  • 12-inch skillet or sauté pan
  • wooden spoon or spatula
  • tongs
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.