Custrd is out on the App Store — Download it free →
Back to recipes

Breaded Cutlet with Mushrooms

A quick and satisfying weeknight dinner: crispy breaded cutlets topped with savory sautéed mushrooms. Ready in about 20 minutes with simple ingredients.

Total time
20 min
Servings
4
Calories
350
Protein
28g
Breaded Cutlet with Mushrooms
comfortingquickAmericanbeefchickencrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Season the 4 cutlets with salt and pepper. Beat the 1 egg in a shallow dish and place the 1 cup breadcrumbs on a plate.

  2. Step 2

    Dip each cutlet into the egg, then press into the breadcrumbs to coat both sides evenly.

  3. Step 3

    Heat 1 tbsp butter in a large skillet over medium-high. Cook the cutlets until golden and crispy, about 3 minutes per side. Transfer to a plate.

  4. Step 4

    In the same skillet, add the remaining 1 tbsp butter and the 8 oz sliced mushrooms. Sauté until browned and tender, about 5 minutes.

  5. Step 5

    Spoon the mushrooms over the cutlets and serve hot.

Tools you’ll need

  • large skillet
  • shallow dish
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.