Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Brie with Jam Crostini

Crispy bread topped with melted brie and sweet jam—ready in 10 minutes. A sophisticated snack that feels special but requires minimal effort.

Total time
10 min
Servings
2
Calories
185
Protein
6g
Brie with Jam Crostini
elegantquickitalianvegetariancrispymeltyappetizerparty

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice baguette diagonally into 0.5-inch-thick pieces. Brush both sides lightly with olive oil.

  2. Step 2

    Arrange slices on a baking sheet and broil 3–4 inches from heat until golden, about 2 minutes per side.

  3. Step 3

    Top each warm slice with a 0.5-inch slice of brie, then 0.5 tsp jam.

  4. Step 4

    Return to broiler for 60–90 seconds until cheese melts and looks glossy.

  5. Step 5

    Serve immediately while brie is still soft.

Tools you’ll need

  • baking sheet
  • broiler
  • serrated knife
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.