Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Bruschetta Chicken Skillet

Seared chicken breasts topped with a quick tomato-basil bruschetta mix and melted mozzarella. Fresh, tangy, and ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
385
Protein
42g
Bruschetta Chicken Skillet
quickfreshitaliangluten-freechickencrispytendermelty

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken breasts dry and season both sides generously with salt and black pepper.

  2. Step 2

    Heat olive oil in a 10-inch skillet over medium-high until it shimmers, about 90 seconds.

  3. Step 3

    Sear chicken 6-7 minutes per side without moving. Edges should look golden; center stays opaque.

  4. Step 4

    Dice tomatoes and toss with basil, minced garlic, balsamic vinegar, and a pinch of salt.

  5. Step 5

    Spoon tomato mixture over each chicken breast and top with mozzarella.

  6. Step 6

    Cover skillet with foil and cook 2-3 minutes until cheese melts and tomatoes soften.

Tools you’ll need

  • 10-inch skillet
  • cutting board
  • chef's knife
  • aluminum foil
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.