Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Kajang Satay Skewers

Charred chicken and shrimp skewers glazed with a quick peanut sauce spiked with chili and lime. Kajang-style satay hits in 15 minutes with just a hot skillet.

Total time
15 min
Servings
2
Calories
485
Protein
38g
Kajang Satay Skewers
casualsatisfyingmalaysiangluten-freechickenshrimpcrispytender

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    If using wooden skewers, soak in water for 5 minutes. Thread chicken and shrimp alternately onto each skewer.

  2. Step 2

    Season skewers generously with salt and pepper on both sides.

  3. Step 3

    Heat oil in a large skillet over medium-high until shimmering. Sear skewers 2 minutes per side until edges char and shrimp pink.

  4. Step 4

    While skewers cook, whisk peanut butter, chili paste, lime juice, and coconut milk in a bowl until smooth.

  5. Step 5

    Transfer skewers to a plate. Pour peanut sauce into the same skillet and warm over low heat, stirring, 90 seconds.

  6. Step 6

    Return skewers to the skillet and coat in sauce. Serve hot with lime wedges and extra sauce for dipping.

Tools you’ll need

  • wooden or metal skewers (8-inch)
  • 12-inch skillet
  • small bowl
  • whisk
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.