Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Bun Cha Gio with Crispy Spring Rolls

Vietnamese vermicelli bowl loaded with crispy fried spring rolls, lettuce, herbs, and tangy fish sauce dipping sauce. A weeknight dinner that tastes restaurant-fresh in under 20 minutes.

Total time
18 min
Servings
2
Calories
420
Protein
12g
20-Min Bun Cha Gio with Crispy Spring Rolls
casualsatisfyingvietnameseshrimpcrispytenderBreadweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a pot, add vermicelli noodles, and cook until tender, ~5 minutes. Drain, rinse with cold water, and set aside.

  2. Step 2

    Heat oil in a deep skillet or wok to 350°F (or until a wooden spoon handle sizzles when touched to surface). Fry spring rolls 2–3 minutes per side until golden and crispy.

  3. Step 3

    Transfer spring rolls to a paper towel-lined plate. Let cool 1 minute, then break each into halves.

  4. Step 4

    Whisk fish sauce with lime juice and 2 tbsp water. Taste and adjust—it should balance salty, sour, and umami.

  5. Step 5

    Divide noodles and lettuce between two bowls. Top with spring roll pieces and scattered herbs.

  6. Step 6

    Pour fish sauce dressing over the bowl. Serve immediately while spring rolls are still crispy.

Tools you’ll need

  • large pot
  • deep skillet or wok
  • thermometer (optional)
  • paper towels
  • small bowl (for dressing)
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.