Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Rice Paper Rolls with Peanut Dip

Shatteringly crispy fried rice paper wrapped around fresh herbs and vegetables, dunked in a punchy peanut-lime sauce. Total TikTok dinner—ready in 25 minutes, looks impossible, tastes like a Vietnamese street cart.

Total time
25 min
Servings
2
Calories
420
Protein
12g
Crispy Rice Paper Rolls with Peanut Dip
freshcasualvietnamesevegetariandairy-freevegetariancrispytender

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk peanut butter, lime juice, fish sauce, 2 tbsp water, and a pinch of sugar until smooth. Add more water if too thick.

  2. Step 2

    Heat oil in a heavy skillet over medium-high until a wooden chopstick dipped in sizzles immediately, ~3 minutes.

  3. Step 3

    Gently lay one rice paper sheet flat. Top with a small pinch each of herbs, cucumber, and carrot—don't overstuff.

  4. Step 4

    Roll the sheet tightly, folding in the sides like a burrito. Repeat with remaining sheets.

  5. Step 5

    Working in batches, slide rolls into hot oil and fry 60–90 seconds per side until they're golden brown and crackling.

  6. Step 6

    Drain on paper towels. Serve hot with peanut sauce on the side for dipping.

Tools you’ll need

  • small mixing bowl
  • whisk
  • heavy skillet or wok (12-inch preferred)
  • wooden chopstick or probe thermometer
  • paper towels
  • slotted spoon or spider skimmer

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.