Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Butter-Sage Tortelli di Zucca

Fresh pumpkin tortelli tossed in a silky brown-butter sauce with crispy sage. A 15-minute weeknight pasta that tastes like a long, slow kitchen afternoon.

Total time
15 min
Servings
2
Calories
385
Protein
14g
Butter-Sage Tortelli di Zucca
elegantcomfortitalianvegetarianvegetariantendermeltyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a pot of salted water to a rolling boil.

  2. Step 2

    Add tortelli and cook until they float, then another minute—until edges look tender.

  3. Step 3

    While they cook, melt butter in a skillet over medium, add garlic and cook until fragrant, 30 seconds.

  4. Step 4

    Add sage leaves and let them crisp, stirring, until edges darken, about 1 minute.

  5. Step 5

    Drain tortelli, add to skillet, and gently toss until coated—butter should look foamy and nutty.

  6. Step 6

    Divide between bowls, grate lemon zest over top, finish with Parmigiano-Reggiano, squeeze lemon juice.

Tools you’ll need

  • large pot
  • 12-inch skillet or saucepan
  • microplane or zester
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.