Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spinach Ricotta Tortelloni

Jarred tortelloni with a silky brown butter and sage sauce — the kind of weeknight dinner that tastes like you spent an hour in the kitchen but took 15 minutes. Nutty, aromatic, complete.

Total time
15 min
Servings
2
Calories
520
Protein
22g
Spinach Ricotta Tortelloni
comfortelegantitalianvegetariancheesecreamytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a large pot of salted water to a boil. Add tortelloni and cook until they float, then 1 minute more, ~4 minutes total.

  2. Step 2

    While pasta cooks, melt butter in a large skillet over medium heat. Add sage and garlic, stirring constantly until fragrant, ~90 seconds.

  3. Step 3

    Keep stirring the butter—it will foam and turn golden-brown with toasted bits at the bottom, ~2 more minutes. Don't let it burn.

  4. Step 4

    Reserve 1 cup pasta water. Drain tortelloni and add to the butter sauce with lemon juice and red pepper flakes.

  5. Step 5

    Toss gently, adding pasta water 2 tablespoons at a time until the sauce coats each tortelloni and looks glossy.

  6. Step 6

    Divide between bowls. Top with lemon zest, Parmigiano-Reggiano, and a pinch of red pepper flakes. Serve immediately.

Tools you’ll need

  • large pot
  • large skillet
  • wooden spoon
  • microplane (for lemon zest)
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.