CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Buttermilk Scones with Jam & Clotted Cream

Tender, flaky scones baked fresh in 15 minutes with a tender crumb and golden top. Serve warm with clotted cream and jam for an elegant breakfast or afternoon tea.

Total time
20 min
Servings
4
Calories
340
Protein
5g
20-Min Buttermilk Scones with Jam & Clotted Cream
elegantcozyamericanvegetarianflakytendercrumblybrunch

Ingredients

  • 2 cups all-purpose flour
  • 6 tbsp cold butter, cubed
  • 2 tbsp granulated sugar
  • 2 tsp baking powder
  • ¾ cup buttermilk
  • ½ cup clotted cream
  • ½ cup jam (strawberry, raspberry, or apricot)
  • 1 whole egg, beaten (for egg wash)

Instructions

  1. 1

    Heat oven to 400°F. Line a sheet pan with parchment paper.

  2. 2

    Whisk flour, sugar, baking powder, and a pinch of salt in a large bowl.

  3. 3

    Cut cold butter into the flour with a fork or pastry cutter until the mixture looks like coarse breadcrumbs.

  4. 4

    Pour in buttermilk and fold gently with a spatula until a shaggy dough forms — do not overmix.

  5. 5

    Turn dough onto a lightly floured surface and shape into a 1-inch-thick disk. Cut into 8 wedges with a sharp knife.

  6. 6

    Arrange scones on the sheet pan. Brush the tops with beaten egg.

  7. 7

    Bake until golden brown on top, 12–14 minutes. The edges should look set and the surface glossy.

  8. 8

    Serve warm scones with a dollop of clotted cream and a spoonful of jam on each.

Tools you’ll need

  • sheet pan
  • parchment paper
  • large mixing bowl
  • whisk
  • fork or pastry cutter
  • spatula
  • cutting board
  • sharp knife
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.