Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Buttermilk Scones with Jam & Clotted Cream

Tender, flaky scones baked fresh in 15 minutes with a tender crumb and golden top. Serve warm with clotted cream and jam for an elegant breakfast or afternoon tea.

Total time
20 min
Servings
4
Calories
340
Protein
5g
20-Min Buttermilk Scones with Jam & Clotted Cream
elegantcozyamericanvegetarianflakytendercrumblybrunch

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 400°F. Line a sheet pan with parchment paper.

  2. Step 2

    Whisk flour, sugar, baking powder, and a pinch of salt in a large bowl.

  3. Step 3

    Cut cold butter into the flour with a fork or pastry cutter until the mixture looks like coarse breadcrumbs.

  4. Step 4

    Pour in buttermilk and fold gently with a spatula until a shaggy dough forms — do not overmix.

  5. Step 5

    Turn dough onto a lightly floured surface and shape into a 1-inch-thick disk. Cut into 8 wedges with a sharp knife.

  6. Step 6

    Arrange scones on the sheet pan. Brush the tops with beaten egg.

  7. Step 7

    Bake until golden brown on top, 12–14 minutes. The edges should look set and the surface glossy.

  8. Step 8

    Serve warm scones with a dollop of clotted cream and a spoonful of jam on each.

Tools you’ll need

  • sheet pan
  • parchment paper
  • large mixing bowl
  • whisk
  • fork or pastry cutter
  • spatula
  • cutting board
  • sharp knife
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.