Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Buttery Laminated Wienerbrød in 25 Minutes

Scandinavian pastry magic with puff pastry sheets and a cinnamon-sugar filling. Baked golden and glazed—no yeast or overnight proofing required.

Total time
25 min
Servings
4
Calories
285
Protein
4g
Buttery Laminated Wienerbrød in 25 Minutes
indulgentcozyscandinavianvegetariancrispyflakyweekendbrunch

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Line a baking sheet with parchment paper.

  2. Step 2

    Mix cinnamon and sugar in a small bowl. Spread softened butter on one puff pastry sheet.

  3. Step 3

    Sprinkle the cinnamon-sugar mixture evenly over the buttered pastry.

  4. Step 4

    Place the second pastry sheet on top. Press gently to seal, then cut into 8 rectangles or squares.

  5. Step 5

    Beat the egg and brush over the top of each pastry piece. Arrange on the prepared baking sheet.

  6. Step 6

    Bake for 12–14 minutes until golden brown and puffed. Dust with powdered sugar and serve warm.

Tools you’ll need

  • baking sheet
  • parchment paper
  • small mixing bowl
  • knife (sharp)
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.