CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Buttery Laminated Wienerbrød in 25 Minutes

Scandinavian pastry magic with puff pastry sheets and a cinnamon-sugar filling. Baked golden and glazed—no yeast or overnight proofing required.

Total time
25 min
Servings
4
Calories
285
Protein
4g
Buttery Laminated Wienerbrød in 25 Minutes
indulgentcozyscandinavianvegetariancrispyflakyweekendbrunch

Ingredients

  • 1 package (2 sheets) frozen puff pastry sheets
  • 3 tbsp butter, softened
  • ¼ cup granulated sugar
  • 1 tsp ground cinnamon
  • 1 whole egg, for egg wash
  • 2 tbsp powdered sugar, for dusting

Instructions

  1. 1

    Preheat oven to 400°F. Line a baking sheet with parchment paper.

  2. 2

    Mix cinnamon and sugar in a small bowl. Spread softened butter on one puff pastry sheet.

  3. 3

    Sprinkle the cinnamon-sugar mixture evenly over the buttered pastry.

  4. 4

    Place the second pastry sheet on top. Press gently to seal, then cut into 8 rectangles or squares.

  5. 5

    Beat the egg and brush over the top of each pastry piece. Arrange on the prepared baking sheet.

  6. 6

    Bake for 12–14 minutes until golden brown and puffed. Dust with powdered sugar and serve warm.

Tools you’ll need

  • baking sheet
  • parchment paper
  • small mixing bowl
  • knife (sharp)
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.