Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Butter-Laminated Danish Pastry Board

A TikTok-friendly cheat on wienerbrød using puff pastry, cinnamon sugar, and quick lamination. Layer, swirl, bake, and share—no overnight proofing required.

Total time
25 min
Servings
4
Calories
285
Protein
3g
Butter-Laminated Danish Pastry Board
indulgentcozyscandinavianvegetariancrispyflakybutteryweekend

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 400°F. Line a sheet pan with parchment paper.

  2. Step 2

    Lay puff pastry sheets on a work surface. Spread 1.5 tbsp softened butter evenly over each sheet.

  3. Step 3

    Whisk cinnamon and sugar together, then sprinkle half the mixture over each buttered sheet.

  4. Step 4

    Roll each sheet tightly from the long side into a log. Slice logs into 1-inch rounds.

  5. Step 5

    Arrange rounds cut-side up on the sheet pan. Brush with beaten egg, then sprinkle with fleur de sel.

  6. Step 6

    Bake until puffed and golden brown, 12–15 minutes. Cool 2 minutes before serving.

Tools you’ll need

  • sheet pan
  • parchment paper
  • oven
  • work surface (cutting board or counter)
  • butter knife or offset spatula
  • small bowl
  • whisk
  • serrated knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.