Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cajun Honey Butter Wings

Crispy pan-fried chicken wings tossed in a spicy-sweet cajun honey butter sauce. Ready in 15 minutes — no oven required.

Total time
15 min
Servings
2
Calories
420
Protein
32g
Cajun Honey Butter Wings
indulgentsatisfyingcajunchickencrispytenderweeknightgame-day

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat wings dry with paper towels. Season both sides generously with salt, pepper, and cajun seasoning.

  2. Step 2

    Heat 2 tbsp oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  3. Step 3

    Add wings in a single layer. Cook 5–6 minutes per side without moving until edges are deep golden and crispy.

  4. Step 4

    Add butter, honey, and hot sauce to the pan. Toss wings to coat until glossy, about 60 seconds.

  5. Step 5

    Serve hot on a plate or platter. Drizzle any remaining sauce over the top.

Tools you’ll need

  • 12-inch skillet or larger
  • paper towels
  • tongs or wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.