Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Canelés de Bordeaux

Caramelized French pastries with crispy caramelized exteriors and creamy vanilla-rum interiors. These elegant molds create a showstopping dessert that looks far more complicated than it is.

Total time
90 min
Servings
8
Calories
185
Protein
3g
Canelés de Bordeaux
elegantindulgentfrenchvegetariancrispycreamycaramelizeddate-night

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat milk with vanilla bean in a small saucepan over medium until steaming, ~4 minutes. Remove from heat and let cool 15 minutes.

  2. Step 2

    Strain out vanilla bean, scraping seeds back into milk. Discard the pod.

  3. Step 3

    Whisk flour and sugar together in a large bowl until no lumps remain.

  4. Step 4

    Add eggs to flour mixture and whisk until smooth, ~1 minute.

  5. Step 5

    Pour cooled milk into egg mixture while whisking constantly until fully combined.

  6. Step 6

    Stir in melted butter and rum until fully incorporated.

  7. Step 7

    Strain batter through a fine sieve into a clean bowl to remove any lumps. Cover and chill at least 2 hours, or overnight.

  8. Step 8

    Preheat oven to 450°F. Brush canelé molds generously with melted beeswax or butter inside all crevices.

  9. Step 9

    Place molds on a baking sheet. Pour chilled batter into molds until just below the rim.

  10. Step 10

    Bake at 450°F for 15 minutes until edges are dark brown and caramelized.

  11. Step 11

    Reduce heat to 350°F and bake 30 minutes more until centers are just set but centers still jiggle slightly.

  12. Step 12

    Remove from oven and cool in molds 5 minutes, then invert onto a wire rack to cool completely.

Tools you’ll need

  • canelé molds (8 copper or silicone)
  • small saucepan
  • large mixing bowl
  • whisk
  • fine sieve
  • baking sheet
  • oven thermometer
  • pastry brush
  • wire cooling rack

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.