Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Saint-Honoré Cake

A showstopping French dessert with crispy choux buns arranged on a pastry base, bound together with caramel and topped with whipped cream. Impressive but achievable with store-bought puff pastry.

Total time
75 min
Servings
8
Calories
385
Protein
6g
Saint-Honoré Cake
elegantindulgentfrenchvegetariancrispycreamyfluffyDessert

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Line two baking sheets with parchment paper.

  2. Step 2

    Place puff pastry on one sheet. Prick all over with a fork to prevent puffing.

  3. Step 3

    Combine butter and water in a saucepan. Heat over medium until butter melts and mixture boils, ~2 minutes.

  4. Step 4

    Remove from heat. Stir in flour until a thick dough forms, stirring constantly for 1 minute.

  5. Step 5

    Cool dough 3 minutes, then beat in 3 eggs one at a time, stirring until each is fully incorporated.

  6. Step 6

    Transfer choux to a piping bag fitted with a 0.5-inch tip. Pipe 16–20 small mounds onto the second sheet, spacing 1 inch apart.

  7. Step 7

    Beat remaining egg. Brush each choux bun lightly with beaten egg.

  8. Step 8

    Bake both sheets at 400°F for 20 minutes until puff pastry is golden and choux are light brown.

  9. Step 9

    Remove from oven and cool both sheets on a wire rack for 10 minutes.

  10. Step 10

    In a heavy saucepan, melt 0.5 cup sugar over medium heat, stirring constantly, until amber-colored, ~6 minutes. Do not stir after sugar liquefies—just swirl the pan.

  11. Step 11

    Working quickly, dip base of each choux bun into hot caramel. Arrange in a circle atop the puff pastry base, pressing lightly to adhere.

  12. Step 12

    Drizzle remaining caramel over the choux buns and pastry base, letting it cool and harden, ~15 minutes.

  13. Step 13

    Whip cold cream with 1 tablespoon sugar until stiff peaks form, ~2 minutes.

  14. Step 14

    Transfer cake to a serving plate. Spoon whipped cream into center or dollop on top. Serve immediately.

Tools you’ll need

  • two baking sheets
  • parchment paper
  • fork
  • medium saucepan
  • wooden spoon
  • piping bag
  • 0.5-inch pastry tip
  • heavy saucepan
  • wire rack
  • electric mixer or whisk
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.