Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cantonese Fish Congee

Silky rice porridge infused with ginger and topped with tender white fish, crispy shallots, and fresh scallions. A warming, restorative one-pot meal ready in under 45 minutes.

Total time
40 min
Servings
2
Calories
385
Protein
24g
Cantonese Fish Congee
comfortwholesomechinesefishcreamytenderweeknightcomfort-food-night

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Rinse the rice in a fine-mesh strainer under cool running water, stirring gently with your fingers for about 30 seconds until the water runs clear — this removes excess starch so the congee will be creamy, not gluey.

  2. Step 2

    Mince the ginger until the pieces are smaller than a grain of rice — about the size of pencil-tip dots — and set in a small bowl.

  3. Step 3

    Lay the fish fillet flat on a cutting board, then slice it at a slight diagonal into 1-inch-wide strips about 2 inches long, like cutting ribbons across the grain.

  4. Step 4

    Slice the scallions crosswise into thin rings — separate the white parts from the green parts and set them in two different small bowls.

  5. Step 5

    Pour the broth into a large pot and bring it to a boil over high heat, watching until you see large bubbles rolling rapidly across the surface, about 5 minutes.

  6. Step 6

    Add the rinsed rice to the boiling broth, stir once, and reduce the heat to medium-low so the broth maintains a gentle simmer — you should see small bubbles breaking the surface slowly.

  7. Step 7

    Simmer uncovered for 25 minutes, stirring once every 5 minutes to prevent the rice from sticking to the bottom, until the rice grains break apart easily when you press one between your fingers.

  8. Step 8

    Stir the minced ginger into the congee, then add the fish strips one piece at a time, stirring gently after each addition so they separate and cook evenly.

  9. Step 9

    Simmer for 3 minutes without stirring, until the fish is opaque throughout when you cut into the thickest piece — it should not have any translucent or gray areas.

  10. Step 10

    Remove the pot from heat, then stir in the soy sauce and sesame oil until fully blended.

  11. Step 11

    Ladle the congee into two bowls, dividing the fish and broth equally between them.

  12. Step 12

    Scatter the white scallion rings, then the green scallion rings, and finally the crispy shallots over the surface of each bowl in a thin, even layer.

Tools you’ll need

  • large pot (at least 3-quart capacity)
  • fine-mesh strainer
  • cutting board
  • chef's knife
  • small bowls (2–3)
  • wooden spoon or large spoon
  • ladle
  • serving bowls (2)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.