Custrd is out on the App Store — Download it free →
Back to recipes

Caramel Custard

A silky, creamy custard with a rich caramel sauce, topped with a fresh mint leaf. This quick and easy dessert is perfect for a weeknight treat.

Total time
35 min
Servings
2
Calories
280
Protein
10g
Caramel Custard
comfortingfrenchvegetariangluten-freeeggcreamysilkyweeknight

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    In a small saucepan, melt 1/4 cup sugar over medium heat until amber, about 5 minutes. Quickly pour into two ramekins, tilting to coat bottoms.

  2. Step 2

    In a bowl, whisk 2 eggs with remaining 1/4 cup sugar and 1 tsp vanilla until smooth. Gradually whisk in 1.5 cups milk.

  3. Step 3

    Pour custard over caramel in ramekins. Place in a baking dish with hot water halfway up sides. Bake at 350°F until set but jiggly, 25-30 minutes.

  4. Step 4

    Cool slightly, then run a knife around edges and invert onto plates. Garnish with 2 mint leaves.

Tools you’ll need

  • small saucepan
  • 2 ramekins
  • baking dish
  • whisk
  • mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.