Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Caramelized Banana Brûlée

Silky custard base with caramelized banana slices and a shattering sugar crust. A TikTok-easy French dessert that looks restaurant-quality but takes just 20 minutes.

Total time
20 min
Servings
4
Calories
342
Protein
3g
Caramelized Banana Brûlée
elegantindulgentfrenchvegetariancreamycrispycaramelizeddate-night

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat cream in a saucepan over medium until steaming, ~3 minutes. Whisk egg yolks with 1/4 cup sugar until pale.

  2. Step 2

    Slowly pour hot cream into yolk mixture while whisking constantly to avoid scrambling eggs.

  3. Step 3

    Return mixture to saucepan over low heat, stirring constantly until it coats the back of a spoon, ~4 minutes. Add vanilla, then pour into a bowl.

  4. Step 4

    Slice bananas 1/4-inch thick. Melt butter in a skillet over medium-high, then sauté banana slices until golden-brown, ~2 minutes per side.

  5. Step 5

    Divide custard into 4 serving dishes or ramekins. Top each with caramelized banana slices.

  6. Step 6

    Sprinkle 1 tbsp sugar evenly over each dish. Use a kitchen torch to caramelize until deep golden and crackling, ~30 seconds per dish.

Tools you’ll need

  • saucepan
  • whisk
  • skillet
  • 4 ramekins or serving bowls
  • kitchen torch
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.