Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Caramelized Grilled Pineapple with Lime & Chili

Charred pineapple wedges get a sticky-sweet glaze with lime juice, brown sugar, and a whisper of chili heat. Serve hot with coconut yogurt and crispy rice cereal for the ultimate Hawaiian weeknight dessert or side.

Total time
15 min
Servings
2
Calories
185
Protein
3g
Caramelized Grilled Pineapple with Lime & Chili
refreshingsimplehawaiianvegetarianvegangluten-freecrispyjuicy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat pineapple wedges dry with a paper towel. Brush with olive oil and sprinkle salt on both sides.

  2. Step 2

    Heat a grill pan or outdoor grill to medium-high until water flicks sizzle on contact, ~2 minutes.

  3. Step 3

    Lay pineapple wedges on the grill and cook 3 minutes without moving until deep char marks appear.

  4. Step 4

    Flip each wedge and cook 2 more minutes on the other side until caramelized and juices pool at the edges.

  5. Step 5

    Transfer pineapple to a plate. Drizzle with lime juice, sprinkle brown sugar and chili flakes while still hot.

  6. Step 6

    Serve warm with a dollop of coconut yogurt and a handful of crispy rice cereal sprinkled on top.

Tools you’ll need

  • grill pan or outdoor grill
  • paper towels
  • tongs or spatula
  • small plate
  • spoon for drizzling

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.