Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Caramelized Onion & Mushroom Pastry

A speedy take on rogal świętomarciński—crispy puff pastry swirls filled with deeply caramelized onions, sautéed mushrooms, and melted cheese. Ready in 20 minutes and perfect for dinner.

Total time
20 min
Servings
4
Calories
385
Protein
11g
Caramelized Onion & Mushroom Pastry
comfortcozypolishvegetariancheesecrispyflakytender

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice onions thin. Heat oil in a large skillet over medium-high heat, add onions with a pinch of salt, and cook 8–10 minutes, stirring often, until deep golden brown and caramelized.

  2. Step 2

    Add sliced mushrooms to the skillet and cook 3–4 minutes until softened and any liquid evaporates. Stir in thyme, then remove from heat and let cool 2 minutes.

  3. Step 3

    Unroll thawed puff pastry on a work surface. Spread caramelized onion and mushroom mixture evenly over it, leaving a 0.5-inch border. Sprinkle shredded cheese over the filling.

  4. Step 4

    Starting at one long edge, tightly roll the pastry into a log. Place seam-side down on a parchment-lined baking sheet and curl into a snail shape if desired.

  5. Step 5

    Whisk egg yolk with 1 tbsp water. Brush the pastry all over with the egg wash and sprinkle caraway seeds on top if using.

  6. Step 6

    Bake at 400°F for 12–15 minutes until the pastry is puffed and deep golden brown. Cool 2 minutes, slice, and serve hot.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • cutting board
  • chef's knife
  • parchment paper
  • baking sheet
  • small bowl (for egg wash)
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.