Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Min Rogal Świętomarcinski (Poznań Croissant)

Buttery puff pastry swirled with caramelized onions and mushrooms, baked until golden and crispy. A TikTok-friendly version of Poznań's iconic pastry—skip the lamination, use store-bought dough, and you've got a show-stopping dinner.

Total time
25 min
Servings
2
Calories
520
Protein
14g
25-Min Rogal Świętomarcinski (Poznań Croissant)
elegantcomfortpolishvegetarianvegetariancrispyflakytender

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice onions into thin half-moons. Slice mushrooms 1/4-inch thick.

  2. Step 2

    Heat butter in a large skillet over medium. Add onions and cook, stirring occasionally, until golden and soft, ~12 minutes. Season with salt and pepper.

  3. Step 3

    Add mushrooms and thyme to the skillet. Cook 3 minutes until mushrooms release liquid and edges brown. Remove from heat and cool slightly, ~2 minutes.

  4. Step 4

    Lay a pastry sheet on a parchment-lined sheet pan. Spread the onion-mushroom mixture evenly over it, leaving 1/2 inch at the edges.

  5. Step 5

    Sprinkle cheese over the filling. Roll the pastry tightly into a log, then coil it into a spiral. Tuck the end underneath.

  6. Step 6

    Whisk the egg with 1 tbsp water. Brush the spiral with egg wash and sprinkle with caraway seeds if using.

  7. Step 7

    Bake at 400°F until deep golden brown, ~10 minutes. Let cool 2 minutes before slicing into wedges.

Tools you’ll need

  • chef's knife
  • large skillet
  • sheet pan
  • parchment paper
  • small bowl (for egg wash)
  • whisk
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.