Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cast Iron Skillet Cornbread

Golden, slightly sweet cornbread baked in a cast iron skillet with a crispy crust. Perfect alongside chili, soup, or as a standalone snack with honey butter.

Total time
30 min
Servings
8
Calories
165
Protein
3g
Cast Iron Skillet Cornbread
comfortsimpleamericanvegetariancrispytenderfluffyMain course

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Place a 10-inch cast iron skillet in the oven.

  2. Step 2

    Whisk together cornmeal, flour, sugar, baking powder, and salt in a large bowl.

  3. Step 3

    Whisk milk and egg together in a separate bowl until combined.

  4. Step 4

    Stir milk mixture into cornmeal mixture until just combined—don't overmix.

  5. Step 5

    Carefully remove hot skillet from oven. Add 3 tbsp butter and swirl to coat.

  6. Step 6

    Pour batter into the hot skillet. Bake 18–22 minutes until golden brown and a toothpick inserted in the center comes out clean.

  7. Step 7

    Cool in the skillet for 5 minutes, then turn out onto a cutting board.

Tools you’ll need

  • 10-inch cast iron skillet
  • oven
  • large mixing bowl
  • small bowl
  • whisk
  • measuring cups and spoons
  • toothpick

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.