Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Charred Fish Bun Cha Ca

Crispy pan-seared white fish over vermicelli noodles with a bright dill-forward Vietnamese sauce. Quick, fragrant, and tastes like you spent hours at the stove.

Total time
20 min
Servings
2
Calories
385
Protein
32g
20-Min Charred Fish Bun Cha Ca
freshlightvietnamesefishcrispytenderweeknightbowl

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil vermicelli in salted water until tender, about 5 minutes. Drain and set aside.

  2. Step 2

    Whisk fish sauce, sugar, and juice of half the lime with 3 tbsp water. Taste and adjust balance of salty/sour/sweet.

  3. Step 3

    Pat fish fillets very dry with paper towels. Season both sides generously with salt and black pepper.

  4. Step 4

    Heat 2 tbsp oil in a skillet over medium-high until it shimmers. Lay fish in pan without moving—sear 3 minutes until edges turn golden.

  5. Step 5

    Flip fish once. Cook 2 minutes more until opaque throughout and skin crisps. Transfer to plate.

  6. Step 6

    Divide noodles and dill between bowls. Top with flaked fish, drizzle sauce, squeeze remaining lime juice. Serve immediately.

Tools you’ll need

  • medium pot
  • 12-inch skillet or larger
  • small bowl or cup
  • whisk
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.