CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Charred Grilled Broccoli with Bread & Potatoes

Crispy-edged broccoli florets hit a hot grill until blackened and tender, served alongside warm bread rolls and roasted potatoes. A dinnertime side-plus-plate that feels fancy but takes 20 minutes flat.

Total time
20 min
Servings
4
Calories
185
Protein
8g
Charred Grilled Broccoli with Bread & Potatoes
simplewholesomeamericanvegetariancrispytenderweeknightdinner

Ingredients

  • 1.5 lbs broccoli, cut into florets
  • 3 tbsp olive oil
  • ½ tsp salt
  • 4 count bread rolls, warmed
  • 2 cups roasted potatoes, warm
  • ¼ cup grated parmesan cheese

Instructions

  1. 1

    Toss broccoli florets with olive oil and salt until coated.

  2. 2

    Heat grill to medium-high and let it preheat for 2 minutes.

  3. 3

    Grill broccoli 3–4 minutes per side until edges char and stems soften.

  4. 4

    Plate grilled broccoli alongside warm bread rolls and roasted potatoes.

  5. 5

    Scatter parmesan over the broccoli and serve immediately.

Tools you’ll need

  • grill (gas or charcoal)
  • cutting board
  • chef's knife
  • large bowl
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.