Charred Grilled Broccoli with Bread & Potatoes
Crispy-edged broccoli florets hit a hot grill until blackened and tender, served alongside warm bread rolls and roasted potatoes. A dinnertime side-plus-plate that feels fancy but takes 20 minutes flat.
- Total time
- 20 min
- Servings
- 4
- Calories
- 185
- Protein
- 8g

simplewholesomeamericanvegetariancrispytenderweeknightdinner
Ingredients
- 1.5 lbs broccoli, cut into florets
- 3 tbsp olive oil
- ½ tsp salt
- 4 count bread rolls, warmed
- 2 cups roasted potatoes, warm
- ¼ cup grated parmesan cheese
Instructions
- 1
Toss broccoli florets with olive oil and salt until coated.
- 2
Heat grill to medium-high and let it preheat for 2 minutes.
- 3
Grill broccoli 3–4 minutes per side until edges char and stems soften.
- 4
Plate grilled broccoli alongside warm bread rolls and roasted potatoes.
- 5
Scatter parmesan over the broccoli and serve immediately.
Tools you’ll need
- grill (gas or charcoal)
- cutting board
- chef's knife
- large bowl
- tongs
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



