Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Charred Grilled Broccoli with Bread & Potatoes

Crispy-edged broccoli florets hit a hot grill until blackened and tender, served alongside warm bread rolls and roasted potatoes. A dinnertime side-plus-plate that feels fancy but takes 20 minutes flat.

Total time
20 min
Servings
4
Calories
185
Protein
8g
Charred Grilled Broccoli with Bread & Potatoes
simplewholesomeamericanvegetariancrispytenderweeknightdinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toss broccoli florets with olive oil and salt until coated.

  2. Step 2

    Heat grill to medium-high and let it preheat for 2 minutes.

  3. Step 3

    Grill broccoli 3–4 minutes per side until edges char and stems soften.

  4. Step 4

    Plate grilled broccoli alongside warm bread rolls and roasted potatoes.

  5. Step 5

    Scatter parmesan over the broccoli and serve immediately.

Tools you’ll need

  • grill (gas or charcoal)
  • cutting board
  • chef's knife
  • large bowl
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.