Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Charred Street Corn with Mayo & Cotija

Grilled corn on the cob brushed with mayo, dusted with chili powder and parmesan — street-food style in under 15 minutes. Crispy, tangy, and dangerously addictive.

Total time
12 min
Servings
2
Calories
210
Protein
7g
Charred Street Corn with Mayo & Cotija
casualfreshamericanmexicanvegetariancrispytenderweeknight

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a grill or cast iron skillet over medium-high until very hot, about 2 minutes.

  2. Step 2

    Brush each corn ear on all sides with mayo until evenly coated.

  3. Step 3

    Grill corn, turning every 90 seconds, until charred and dark in spots, about 8 minutes total.

  4. Step 4

    Mix parmesan and chili powder in a small bowl.

  5. Step 5

    Roll each hot corn cob in the parmesan-chili mixture until coated.

  6. Step 6

    Serve immediately with any extra cheese mixture on the side.

Tools you’ll need

  • grill or 12-inch cast iron skillet
  • small bowl
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.