Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chäschüechli (Swiss Cheese Pastries)

Crispy, golden pastry pockets filled with melted Gruyère and onions—a beloved Swiss comfort food. Baked until the edges curl and the cheese oozes from within.

Total time
45 min
Servings
4
Calories
520
Protein
18g
Chäschüechli (Swiss Cheese Pastries)
comfortrusticswissvegetariancheesecrispymeltyflaky

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F (200°C). Line a baking sheet with parchment paper.

  2. Step 2

    Melt butter in a large skillet over medium heat. Add sliced onions, salt, and pepper.

  3. Step 3

    Cook onions, stirring occasionally, until golden and very soft, about 12 minutes. Stir in thyme.

  4. Step 4

    Transfer onions to a plate to cool slightly. Let cool for 5 minutes.

  5. Step 5

    Thaw puff pastry sheets at room temperature until pliable, about 10 minutes.

  6. Step 6

    Cut each pastry sheet into 4 equal squares (8 total). Place on prepared baking sheet.

  7. Step 7

    Divide shredded Gruyère among pastry squares, leaving a 0.5-inch border. Top each with caramelized onions.

  8. Step 8

    Fold each square diagonally in half to form a triangle. Press edges gently to seal.

  9. Step 9

    Brush pastry triangles with beaten egg for a golden finish.

  10. Step 10

    Bake until pastries are puffed and deep golden brown, about 15 minutes. Serve hot.

Tools you’ll need

  • baking sheet
  • parchment paper
  • large skillet
  • wooden spoon
  • cutting board
  • sharp knife
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.