Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Crispy Cheese Pogácsa

Hungarian cheese pastry puffs — buttery, crispy, and ready in 15 minutes using puff pastry and a sheet pan. Savory, satisfying, and perfect for snacking or a light dinner.

Total time
15 min
Servings
4
Calories
312
Protein
9g
15-Min Crispy Cheese Pogácsa
casualcomforthungarianvegetariancheesecrispyflakytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 400°F. Line a sheet pan with parchment paper.

  2. Step 2

    Mix grated cheddar, sour cream, caraway seeds, and paprika in a bowl until combined.

  3. Step 3

    Lay puff pastry on the prepared pan. Spread cheese mixture evenly over the entire sheet.

  4. Step 4

    Brush the top with beaten egg until the surface looks glossy.

  5. Step 5

    Bake for 10 minutes until the pastry is golden brown and the edges puff up.

  6. Step 6

    Cool for 2 minutes, then cut into 12 rectangles or squares and serve warm.

Tools you’ll need

  • sheet pan
  • parchment paper
  • small bowl
  • pastry brush
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.