Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cheesy Beef Zucchini Boats

Hollowed zucchini halves stuffed with seasoned ground beef, tomato, and melted cheese, then baked until golden. A Mediterranean weeknight dinner that feels fancy but takes 25 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
32g
Cheesy Beef Zucchini Boats
comfortsatisfyingmediterraneanbeeftendermeltyweeknightmain-dish

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Halve the zucchini lengthwise. Scoop out the flesh, leaving a 1/4-inch shell. Chop the scooped flesh and set aside.

  2. Step 2

    Heat oil in a skillet over medium-high. Brown ground beef, breaking it up with a spoon, until no pink remains, ~5 minutes.

  3. Step 3

    Add garlic and cook 30 seconds until fragrant. Stir in chopped zucchini flesh, diced tomato, oregano, salt, and pepper.

  4. Step 4

    Simmer 3 minutes to evaporate excess liquid, stirring occasionally, then remove from heat.

  5. Step 5

    Arrange zucchini boats in a baking dish. Divide beef mixture evenly among them, then top each with mozzarella and parmesan.

  6. Step 6

    Bake at 400°F for 8 minutes until cheese melts and tops turn golden. Serve hot.

Tools you’ll need

  • sharp knife
  • spoon
  • 12-inch skillet
  • baking dish (9x13 or similar)
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.