Sheet Pan Philly Cheesesteak

Sliced beef, peppers, onions, and melted cheese roasted together on one sheet pan in under 20 minutes. No sandwich required—pile it on a plate and eat it hot.

Total time: 18 min
Servings: 2
Calories: 420
Protein: 38g

comfortsatisfyingamericanbeeftendermeltyweeknightmain-dish

Ingredients

4 items — tap to check off

¾ lb beef sirloin or ribeye, thinly sliced
2 medium bell peppers (1 red, 1 yellow), sliced into strips
1 large onion, sliced into thin half-moons
6 oz provolone or cheddar cheese, sliced or shredded

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

Step 1
Toss beef, peppers, and onion with 2 tbsp oil, salt, and pepper on a sheet pan until evenly coated.
Step 2
Spread in a single layer and roast at 425°F for 12 minutes until beef browns and peppers soften.
Step 3
Scatter cheese over the top and roast 2 more minutes until melted and bubbly.
Step 4
Serve hot straight from the pan with crusty bread on the side if desired.

Tools you’ll need

sheet pan
oven (preheated to 425°F)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.

Try the free recipe finder

Ingredients

Instructions

Tools you’ll need

Get matched recipes for what’s in your fridge

More recipes like this