Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Cheesy Ham & Potato Skillet

Diced ham and potatoes get crispy in a skillet, then tossed with melted cheddar and sour cream for a creamy, rich one-pan dinner that tastes way better than it should. Ready in 20 minutes.

Total time
20 min
Servings
4
Calories
520
Protein
32g
20-Min Cheesy Ham & Potato Skillet
comfortheartyamericanporkcreamycrispyweeknightmain-dish

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over medium-high heat until shimmering.

  2. Step 2

    Add diced potatoes and cook, stirring occasionally, until golden and tender, ~12 minutes.

  3. Step 3

    Stir in ham and cook 2 minutes until edges warm through.

  4. Step 4

    Remove from heat and fold in cheddar and sour cream until melted and creamy.

  5. Step 5

    Season with salt and pepper to taste, then serve hot.

Tools you’ll need

  • 12-inch skillet or larger
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.