Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cheesy Potato Locro

Creamy, comforting Ecuadorian potato stew finished with melted cheese and crispy onions. A weeknight version of the classic — boiled potatoes, simple aromatics, and a splash of cream that comes together in one pot.

Total time
22 min
Servings
4
Calories
420
Protein
18g
Cheesy Potato Locro
comfortcozyecuadorianvegetariancheesecreamytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil potatoes and onion half in salted water until potatoes are tender, ~12 minutes.

  2. Step 2

    Drain and remove onion. Return potatoes to the warm pot off heat.

  3. Step 3

    Pour milk over potatoes, then stir in shredded cheddar until melted and creamy.

  4. Step 4

    Taste and season with salt and black pepper. Simmer 2 minutes over low heat.

  5. Step 5

    Divide into bowls. Top with crumbled queso fresco, avocado, and cilantro.

Tools you’ll need

  • large pot
  • colander
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.