Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Potato & Cheese Locro

Ecuadorian comfort in a pot: waxy potatoes, melty cheese, and toasted cumin in a savory cream broth. Ready in 25 minutes, feeds 4.

Total time
25 min
Servings
4
Calories
380
Protein
12g
Creamy Potato & Cheese Locro
comfortcozyecuadorianvegetariancheesecreamytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toast cumin seeds in a large pot over medium heat for 60 seconds until fragrant.

  2. Step 2

    Add diced onion to the pot and cook, stirring, for 2 minutes until softened.

  3. Step 3

    Pour in vegetable broth and add potato cubes. Bring to a boil, then simmer for 12 minutes until potatoes are tender.

  4. Step 4

    Stir in milk and bring back to a gentle simmer for 2 minutes.

  5. Step 5

    Remove from heat. Add grated cheese in handfuls, stirring until fully melted and smooth.

  6. Step 6

    Taste and adjust salt and pepper. Garnish with cilantro or scallions and serve hot.

Tools you’ll need

  • large pot (4-quart or bigger)
  • wooden spoon
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.