CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Creamy Potato & Cheese Locro

Ecuadorian comfort in a pot: waxy potatoes, melty cheese, and toasted cumin in a savory cream broth. Ready in 25 minutes, feeds 4.

Total time
25 min
Servings
4
Calories
380
Protein
12g
Creamy Potato & Cheese Locro
comfortcozyecuadorianvegetariancheesecreamytenderweeknight

Ingredients

  • 1.5 lbs waxy potatoes (about 1.5 lbs), peeled and cut into 3/4-inch cubes
  • 1 medium yellow onion, diced
  • 1 cup whole milk
  • 3 cups vegetable broth
  • 1 cup sharp cheddar cheese, grated
  • 1 tsp cumin seeds
  • 2 tbsp fresh cilantro (chopped) or scallions

Instructions

  1. 1

    Toast cumin seeds in a large pot over medium heat for 60 seconds until fragrant.

  2. 2

    Add diced onion to the pot and cook, stirring, for 2 minutes until softened.

  3. 3

    Pour in vegetable broth and add potato cubes. Bring to a boil, then simmer for 12 minutes until potatoes are tender.

  4. 4

    Stir in milk and bring back to a gentle simmer for 2 minutes.

  5. 5

    Remove from heat. Add grated cheese in handfuls, stirring until fully melted and smooth.

  6. 6

    Taste and adjust salt and pepper. Garnish with cilantro or scallions and serve hot.

Tools you’ll need

  • large pot (4-quart or bigger)
  • wooden spoon
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.