Cheesy Spinach Ravioli Bake
Frozen ravioli and spinach baked together with marinara and melted mozzarella—ready in under 25 minutes. Serve with garlic bread for a complete, zero-effort weeknight dinner.
- Total time
- 24 min
- Servings
- 4
- Calories
- 520
- Protein
- 28g

comfortquickitalianvegetariancreamymeltyweeknightpasta
Ingredients
- 1 lb frozen ravioli
- 10 oz frozen spinach, thawed and squeezed dry
- 24 oz marinara sauce
- 2 cups mozzarella cheese, shredded
Instructions
- 1
Preheat oven to 400°F.
- 2
Spread half the marinara on the bottom of a 9×13 baking dish.
- 3
Layer frozen ravioli over the sauce, then scatter thawed spinach evenly across.
- 4
Pour remaining marinara over the top, then sprinkle mozzarella in an even layer.
- 5
Bake uncovered 18–20 minutes until cheese bubbles at the edges and center is hot.
- 6
Let rest 2 minutes, then serve with garlic bread.
Tools you’ll need
- 9×13-inch baking dish
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



