Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cheesy Spinach Ravioli Bake

Frozen ravioli and spinach baked together with marinara and melted mozzarella—ready in under 25 minutes. Serve with garlic bread for a complete, zero-effort weeknight dinner.

Total time
24 min
Servings
4
Calories
520
Protein
28g
Cheesy Spinach Ravioli Bake
comfortquickitalianvegetariancreamymeltyweeknightpasta

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F.

  2. Step 2

    Spread half the marinara on the bottom of a 9×13 baking dish.

  3. Step 3

    Layer frozen ravioli over the sauce, then scatter thawed spinach evenly across.

  4. Step 4

    Pour remaining marinara over the top, then sprinkle mozzarella in an even layer.

  5. Step 5

    Bake uncovered 18–20 minutes until cheese bubbles at the edges and center is hot.

  6. Step 6

    Let rest 2 minutes, then serve with garlic bread.

Tools you’ll need

  • 9×13-inch baking dish
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.