CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Cheesy Spinach Ravioli Bake

Frozen ravioli and spinach baked together with marinara and melted mozzarella—ready in under 25 minutes. Serve with garlic bread for a complete, zero-effort weeknight dinner.

Total time
24 min
Servings
4
Calories
520
Protein
28g
Cheesy Spinach Ravioli Bake
comfortquickitalianvegetariancreamymeltyweeknightpasta

Ingredients

  • 1 lb frozen ravioli
  • 10 oz frozen spinach, thawed and squeezed dry
  • 24 oz marinara sauce
  • 2 cups mozzarella cheese, shredded

Instructions

  1. 1

    Preheat oven to 400°F.

  2. 2

    Spread half the marinara on the bottom of a 9×13 baking dish.

  3. 3

    Layer frozen ravioli over the sauce, then scatter thawed spinach evenly across.

  4. 4

    Pour remaining marinara over the top, then sprinkle mozzarella in an even layer.

  5. 5

    Bake uncovered 18–20 minutes until cheese bubbles at the edges and center is hot.

  6. 6

    Let rest 2 minutes, then serve with garlic bread.

Tools you’ll need

  • 9×13-inch baking dish
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.