Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Baked Ziti with Garlic Bread

Cooked ziti tossed with marinara and mozzarella, then baked until bubbly—finished with crispy garlic bread on the side. A weeknight Italian comfort meal ready in under 20 minutes.

Total time
20 min
Servings
4
Calories
520
Protein
22g
20-Min Baked Ziti with Garlic Bread
comfortcasualitalianvegetariancreamymeltyweeknightpasta

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil ziti in salted water until al dente, about 8–10 minutes, then drain.

  2. Step 2

    Toss hot pasta with marinara sauce and 1.5 cups mozzarella in a large bowl.

  3. Step 3

    Pour mixture into a 9x13-inch baking dish, top with remaining 0.5 cup cheese.

  4. Step 4

    Bake at 375°F until cheese melts and edges bubble, about 8–10 minutes.

  5. Step 5

    Bake garlic bread alongside the ziti in the final 3 minutes, until golden.

  6. Step 6

    Serve baked ziti hot with garlic bread on the side.

Tools you’ll need

  • large pot
  • 9x13-inch baking dish
  • large mixing bowl
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.