CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Baked Ziti with Garlic Bread

Cooked ziti tossed with marinara and mozzarella, then baked until bubbly—finished with crispy garlic bread on the side. A weeknight Italian comfort meal ready in under 20 minutes.

Total time
20 min
Servings
4
Calories
520
Protein
22g
20-Min Baked Ziti with Garlic Bread
comfortcasualitalianvegetariancreamymeltyweeknightpasta

Ingredients

  • 1 lb ziti pasta
  • 24 oz marinara sauce
  • 2 cups mozzarella cheese, shredded
  • 1 piece garlic bread (store-bought or homemade)

Instructions

  1. 1

    Boil ziti in salted water until al dente, about 8–10 minutes, then drain.

  2. 2

    Toss hot pasta with marinara sauce and 1.5 cups mozzarella in a large bowl.

  3. 3

    Pour mixture into a 9x13-inch baking dish, top with remaining 0.5 cup cheese.

  4. 4

    Bake at 375°F until cheese melts and edges bubble, about 8–10 minutes.

  5. 5

    Bake garlic bread alongside the ziti in the final 3 minutes, until golden.

  6. 6

    Serve baked ziti hot with garlic bread on the side.

Tools you’ll need

  • large pot
  • 9x13-inch baking dish
  • large mixing bowl
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.