CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Cheesy Tortellini Bake

Cheese tortellini layered with marinara, ricotta, and melted mozzarella, then baked until bubbly and golden. The easiest weeknight casserole that tastes like you tried.

Total time
20 min
Servings
4
Calories
520
Protein
22g
20-Min Cheesy Tortellini Bake
comfortitalianvegetariancheesecreamymeltyweeknightpasta

Ingredients

  • 1 lb cheese tortellini
  • 2 cups marinara sauce
  • ¾ cup ricotta cheese
  • 1.5 cups mozzarella cheese, shredded

Instructions

  1. 1

    Preheat oven to 400°F and boil tortellini in salted water until al dente, ~4 minutes.

  2. 2

    Drain tortellini and toss with 1 cup marinara sauce in a large bowl.

  3. 3

    Spread half the tortellini mixture in an 8x8-inch baking dish, dollop with half the ricotta, then add remaining tortellini and ricotta.

  4. 4

    Pour remaining 1 cup marinara over the top and sprinkle mozzarella evenly across the surface.

  5. 5

    Bake uncovered until cheese bubbles and edges are golden, about 10 minutes.

Tools you’ll need

  • large pot
  • colander
  • large mixing bowl
  • 8x8-inch baking dish
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.