Custrd is out on the App Store — Download it free →
Back to recipes

Chicken Curry With Coconut Milk And Lime

A creamy, aromatic chicken curry with coconut milk, bright lime, and fresh basil, finished with cherry tomatoes for a pop of color and flavor.

Total time
35 min
Servings
4
Calories
450
Protein
35g
Chicken Curry With Coconut Milk And Lime
comfortingexoticThaigluten-freechickencreamytenderweeknight dinner

Ingredients

10 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large pan over medium heat and sauté minced garlic until fragrant.

  2. Step 2

    Add green curry paste and cook for 1 minute, stirring constantly.

  3. Step 3

    Add chicken pieces and cook until lightly browned on all sides.

  4. Step 4

    Pour in coconut milk and water, bring to a simmer, and cook for 15 minutes.

  5. Step 5

    Stir in cherry tomatoes and cook for 5 more minutes until slightly softened.

  6. Step 6

    Remove from heat, squeeze in lime juice, and garnish with basil leaves.

  7. Step 7

    Serve hot with rice or bread.

Tools you’ll need

  • large skillet or pan
  • wooden spoon
  • knife
  • cutting board
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.