Custrd is out on the App Store — Download it free →
Back to recipes

Chicken Fried Rice With Oyster Sauce

A quick and savory Thai-style fried rice with tender chicken, crisp vegetables, and a rich oyster sauce glaze, topped with fresh cilantro and scallions.

Total time
25 min
Servings
4
Calories
420
Protein
28g
Chicken Fried Rice With Oyster Sauce
comfortingquickthaidairy-freechickentendercrispweeknight dinner

Ingredients

10 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice chicken into thin bite-sized pieces and season with a pinch of salt.

  2. Step 2

    Heat oil in a wok over high heat; add chicken and stir-fry until golden and cooked through.

  3. Step 3

    Add diced carrot and bell pepper; stir-fry for 2 minutes until slightly tender.

  4. Step 4

    Add cold cooked rice, breaking up clumps; toss to combine with vegetables and chicken.

  5. Step 5

    Drizzle oyster sauce over the rice and stir-fry for 2-3 minutes until everything is well coated.

  6. Step 6

    Fold in tomato slices and cook for 1 minute just to warm through.

  7. Step 7

    Garnish with chopped cilantro and sliced scallions before serving.

Tools you’ll need

  • wok or large skillet
  • spatula
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.