Custrd is out on the App Store — Download it free →
Back to recipes

Chicken Paitan Ramen

A rich, creamy chicken broth with ramen noodles, tender chicken, and a soft-boiled egg, topped with green onions and a spicy red seasoning. Ready in about 20 minutes for a quick weeknight bowl.

Total time
20 min
Servings
2
Calories
550
Protein
35g
Chicken Paitan Ramen
comfortingsatisfyingJapanesechickeneggcreamychewyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a small pot of water to a boil, then add the 2 eggs and cook for 6-7 minutes for a soft-boiled yolk. Remove and cool in ice water, then peel and set aside.

  2. Step 2

    In a large pot, bring the 4 cups chicken broth to a simmer over medium heat. Add the 1 cup cooked chicken and 2 tablespoons chili garlic sauce, stirring until the broth turns creamy and reddish, about 3 minutes.

  3. Step 3

    Add the 2 packages ramen noodles to the broth and cook until tender, about 3-4 minutes, stirring occasionally.

  4. Step 4

    Slice the peeled eggs in half. Divide the noodles and broth between two bowls, top with the egg halves and sliced green onions, and serve hot.

Tools you’ll need

  • large pot
  • small pot
  • bowl
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.