Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Chicken Salteña Empanadas

Hand-held Bolivian pastry pockets filled with spiced chicken, potatoes, and olives, baked until golden. A weeknight shortcut using store-bought wonton wrappers instead of homemade dough—ready in under 20 minutes.

Total time
20 min
Servings
4
Calories
285
Protein
18g
20-Min Chicken Salteña Empanadas
casualsatisfyingbolivianchickencrispytenderflakyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Microwave diced potato with 2 tbsp water, covered, for 3 minutes until just tender. Drain and cool slightly.

  2. Step 2

    Mix cooked potato, shredded chicken, olives, minced onion, and aji amarillo paste in a bowl. Season with salt and pepper.

  3. Step 3

    Lay a wonton wrapper on a dry surface. Place 1 heaping tbsp filling in the center, leaving a 0.5-inch border.

  4. Step 4

    Brush borders with beaten egg. Fold wrapper in half diagonally to form a triangle, then press edges firmly to seal.

  5. Step 5

    Place sealed empanadas seam-side up on a parchment-lined baking sheet. Brush tops with remaining egg wash.

  6. Step 6

    Bake at 400°F for 10–12 minutes until golden brown and crispy on edges. Serve hot with hot sauce or aji.

Tools you’ll need

  • microwave-safe bowl
  • mixing bowl
  • baking sheet
  • parchment paper
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.