Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chicken Salteña Pockets

Buttery, crispy hand pies filled with spiced chicken, potatoes, and olives—Bolivia's beloved street snack, streamlined for a weeknight. Baked in 20 minutes, served warm with hot sauce.

Total time
25 min
Servings
4
Calories
385
Protein
18g
Chicken Salteña Pockets
casualsatisfyingbolivianchickencrispytenderflakyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Microwave diced potato with 2 tbsp water, covered, for 4 minutes until just tender. Drain well.

  2. Step 2

    Mix shredded chicken, cooked potato, red onion, olives, aji, and cumin in a bowl until combined.

  3. Step 3

    Thaw empanada dough sheets per package (usually 5 min at room temp). Preheat oven to 400°F.

  4. Step 4

    Divide filling among dough sheets. Fold each into a half-moon, press edges to seal, then crimp with a fork.

  5. Step 5

    Place on a parchment-lined sheet pan. Brush tops with beaten egg. Bake for 12 minutes until golden brown.

  6. Step 6

    Let cool 2 minutes. Serve warm with hot sauce on the side.

Tools you’ll need

  • microwave
  • mixing bowl
  • sheet pan
  • parchment paper
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.