Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chilaquiles Verdes with Chicken

Crispy tortilla chips baked with tangy green salsa, topped with shredded chicken and melted cheese. A complete breakfast that comes together in one skillet in under 25 minutes.

Total time
25 min
Servings
2
Calories
520
Protein
38g
Chilaquiles Verdes with Chicken
comfortcasualmexicanchickencrispymeltyweeknightbreakfast

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat the oven to 400°F and position the rack in the middle. Wait for the indicator light to turn off or the beep to sound, confirming the oven is fully heated.

  2. Step 2

    Cut the white onion in half from root to tip, then place each half flat-side down on the cutting board and slice crosswise into thin half-moons about 1/8-inch thick.

  3. Step 3

    Pinch off the cilantro leaves from the stems into a small pile, then use a knife to roughly chop them until the leaves are in small, uneven pieces.

  4. Step 4

    Pour the 1.5 cups salsa verde into a 10-inch skillet and set the skillet on the stovetop over medium heat, stirring occasionally with a wooden spoon, until the salsa just begins to bubble at the edges, about 2 minutes.

  5. Step 5

    Remove the skillet from the heat. Add the 3 cups tortilla chips and the 1.5 cups shredded chicken to the skillet and stir with a wooden spoon until the chips are evenly coated with salsa, about 30 seconds.

  6. Step 6

    Sprinkle the 0.75 cup shredded cheese evenly over the top of the mixture in a single layer, covering as much surface as possible.

  7. Step 7

    Slide the skillet into the preheated 400°F oven on the middle rack and bake until the cheese is melted and bubbly with just a few light brown spots, about 8 minutes.

  8. Step 8

    Remove the skillet from the oven using an oven mitt and place it on a heat-safe surface. Scatter the diced onion and chopped cilantro evenly over the top.

  9. Step 9

    Divide the chilaquiles between two bowls, scooping from the skillet with a spoon to ensure both servings get chips, sauce, and cheese.

Tools you’ll need

  • 10-inch cast iron skillet or oven-safe skillet
  • wooden spoon
  • cutting board
  • chef's knife
  • oven mitt

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.