Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Chilaquiles Verdes with Chicken

Fried tortilla chips tossed in tangy green salsa with shredded chicken and topped with melted cheese. A one-pan Mexican breakfast that's ready in under 25 minutes.

Total time
25 min
Servings
2
Calories
445
Protein
28g
Crispy Chilaquiles Verdes with Chicken
comfortcasualmexicanchickencrispytendermeltyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pour 2 tablespoons olive oil into a 10-inch skillet and place it over medium-high heat for 60 seconds until the oil shimmers and slides quickly when you tilt the pan.

  2. Step 2

    Add 3 cups tortilla chips to the hot oil and stir constantly for 90 seconds until the chips darken slightly and smell toasted, so they stay crispy instead of becoming soggy.

  3. Step 3

    Pour 1.5 cups salsa verde into the skillet and stir everything together for 30 seconds until the chips are evenly coated with green sauce.

  4. Step 4

    Add 1.5 cups shredded cooked chicken to the skillet and stir for 60 seconds until the chicken is warmed through and mixed with the chips and sauce.

  5. Step 5

    Sprinkle 0.75 cup shredded Oaxaca cheese evenly over the top of the mixture in the skillet.

  6. Step 6

    Cover the skillet with a lid or a baking sheet and reduce heat to medium for 120 seconds until the cheese melts completely and looks glossy.

  7. Step 7

    Remove the skillet from heat, taste the chilaquiles, and sprinkle with salt and pepper as needed.

  8. Step 8

    Scoop the chilaquiles into two bowls using a spatula, scraping all the sauce from the bottom of the skillet so nothing is left behind.

Tools you’ll need

  • 10-inch skillet with lid or baking sheet
  • spatula
  • spoon for stirring
  • two bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.